Recombinant Human KCNIP4 protein (ab164260)

Overview

  • Product name
    Recombinant Human KCNIP4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSS PAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPS GVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLS ILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVL KEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
    • Amino acids
      1 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A type potassium channel modulatory protein 4
    • A-type potassium channel modulatory protein 4
    • CALP
    • Calsenilin like protein
    • Calsenilin-like protein
    • HGNC:30083
    • KCHIP 4
    • KChIP4
    • KCIP4_HUMAN
    • KCNIP 4
    • Kcnip4
    • Kv channel interacting protein 4
    • Kv channel-interacting protein 4
    • MGC44947
    • Potassium channel interacting protein 4
    • Potassium channel-interacting protein 4
    see all
  • Function
    Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents.
  • Tissue specificity
    Predominantly expressed in brain.
  • Sequence similarities
    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Domain
    The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164260 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up