Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP48048
    • SpeciesHuman
    • SequenceELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDF HNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
    • Molecular weight37 kDa including tags
    • Amino acids292 to 391

Specifications

Our Abpromise guarantee covers the use of ab114590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP regulated potassium channel ROM K
    • ATP sensitive inward rectifier potassium channel 1
    • ATP-regulated potassium channel ROM-K
    • ATP-sensitive inward rectifier potassium channel 1
    • Inward rectifier K(+) channel Kir1.1
    • inwardly rectifying K+ channel
    • inwardly rectifying subfamily J member 1
    • IRK1_HUMAN
    • KCNJ
    • KCNJ 1
    • Kcnj1
    • Kir 1.1
    • Kir1.1
    • OTTHUMP00000045938
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 1
    • potassium inwardly-rectifying channel J1
    • ROMK
    • ROMK 1
    • ROMK 2
    • ROMK1
    • ROMK2
    see all
  • FunctionIn the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
  • Tissue specificityIn the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.
  • Involvement in diseaseDefects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) [MIM:241200]; also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
  • Sequence similaritiesBelongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ1 subfamily.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human KCNJ1 protein images

  • 12.5% SDS-PAGE showing ab114590 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human KCNJ1 protein (ab114590)

ab114590 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"