Recombinant Human KCNJ15 protein (ab158787)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLY LQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEP ISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQL VITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVA NMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLIL PMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY IPEEVYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQ LEEKYRQEDQRERELRTLLLQQSNV
    • Amino acids
      1 to 375
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP sensitive inward rectifier potassium channel 15
    • ATP-sensitive inward rectifier potassium channel 15
    • Inward rectifier K(+) channel Kir1.3
    • Inward rectifier K(+) channel Kir4.2
    • Inward rectifier K+ channel KIR4.2
    • inwardly rectifying subfamily J member 15
    • IRK15_HUMAN
    • IRKK
    • KCNJ 14
    • KCNJ 15
    • KCNJ14
    • Kcnj15
    • KIR1.3
    • KIR4.2
    • MGC13584
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 15
    • Potassium inwardly rectifying channel J15
    • Potassium inwardly rectifying channel subfamily J member 15
    • Potassium voltage gated channel subfamily J member 15
    see all
  • Function
    Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
  • Sequence similarities
    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ15 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158787 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up