Overview

  • Product name
    Recombinant Human KCNK1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKED QKQNEPFVATQSSACVDGPANH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      265 to 336

Specifications

Our Abpromise guarantee covers the use of ab116746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DPK
    • HOHO
    • HOHO1
    • inward rectifying potassium channel protein TWIK 1
    • Inward rectifying potassium channel protein TWIK-1
    • Inward rectifying potassium channel protein TWIK1
    • K2P1
    • K2p1.1
    • KCNK1
    • KCNK1_HUMAN
    • KCNO1
    • OTTHUMP00000036029
    • Potassium channel KCNO1
    • Potassium channel subfamily K member 1
    • Potassium inwardly rectifying channel subfamily K member 1
    • TWIK 1
    • TWIK1
    see all
  • Function
    Weakly inward rectifying potassium channel.
  • Tissue specificity
    Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney.
  • Sequence similarities
    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human KCNK1 protein images

  • 12.5% SDS-PAGE analysis of ab116746 at approximately 33.55kDa, stained with Coomassie Blue.

References for Recombinant Human KCNK1 protein (ab116746)

ab116746 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up