Recombinant Human KCNK10 protein (ab162721)

Overview

  • Product name
    Recombinant Human KCNK10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEE ETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
    • Amino acids
      439 to 538
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2P domain potassium channel TREK2
    • K2p10.1
    • KCNK10
    • KCNKA_HUMAN
    • Outward rectifying potassium channel protein TREK 2
    • Outward rectifying potassium channel protein TREK-2
    • Potassium channel subfamily K member 10
    • Potassium channel TREK 2
    • TREK 2
    • TREK 2 K
    • TREK 2 K(+) channel subunit
    • TREK-2 K(+) channel subunit
    • TREK2
    • TWIK related K+ channel 2
    see all
  • Function
    Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
  • Tissue specificity
    Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. Isoform b is strongly expressed in kidney (primarily in the proximal tubule) and pancreas, whereas isoform c is abundantly expressed in brain.
  • Sequence similarities
    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162721 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up