Recombinant Human KCNK12 protein (ab163388)

Overview

  • Product name
    Recombinant Human KCNK12 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH
    • Amino acids
      166 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KCNK12
    • KCNKC_HUMAN
    • Potassium channel subfamily K member 12
    • Tandem pore domain halothane-inhibited potassium channel 2
    • Tandem pore domain potassium channel THIK 2
    • THIK 2
    • THIK-2
    see all
  • Function
    Probable potassium channel subunit. No channel activity observed in heterologous systems. May need to associate with another protein to form a functional channel.
  • Sequence similarities
    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163388 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up