Recombinant Human KCNMB4 protein (ab153296)

Overview

  • Product name
    Recombinant Human KCNMB4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQAT EANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALL HSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYF NQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVK AEAMKKRKFS
    • Amino acids
      1 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BK channel subunit beta 4
    • BK channel subunit beta-4
    • BKbeta4
    • Calcium activated potassium channel beta 4 subunit
    • Calcium activated potassium channel subfamily M subunit beta 4
    • Calcium activated potassium channel subunit beta 4
    • Calcium-activated potassium channel
    • Calcium-activated potassium channel subunit beta-4
    • Charybdotoxin receptor subunit beta 4
    • Charybdotoxin receptor subunit beta-4
    • Hbeta4
    • K(VCA)beta 4
    • K(VCA)beta-4
    • KCMB4_HUMAN
    • KCNMB 4
    • Kcnmb4
    • Large conductance calcium dependent potassium ion channel beta 4 subunit
    • Maxi K channel subunit beta 4
    • Maxi K channel subunit beta-4
    • Potassium large conductance calcium activated channel subfamily M beta member 4
    • Slo beta 4
    • Slo-beta-4
    • subfamily M subunit beta-4
    see all
  • Function
    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
  • Tissue specificity
    Predominantly expressed in brain. In brain, it is expressed in the cerebellum, cerebral cortex, medulla, spinal cord, occipital pole, frontal lobe, temporal lobe, putamen, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Weakly or not expressed in other tissues.
  • Sequence similarities
    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB4 subfamily.
  • Domain
    Resistance to charybdotoxin (CTX) toxin is mediated by the extracellular domain.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation modulates its effect on KCNMA1 activation kinetics.
    N-glycosylated. A highly glycosylated form is promoted by KCNMA1. Glycosylation, which is not required for the interaction with KCNMA1 and subcellular location, increases protection against charybdotoxin.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab153296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up