Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MERPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWR IAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDI ILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLM TICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITF LSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHV HNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFL QAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQ IGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTT HTPISDSPIGVSSTSFPTPYTSSSSC
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 426

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hSK3
    • KCa2.3
    • Kcnn3
    • KCNN3_HUMAN
    • Potassium calcium activated channel subfamily N member 3
    • Potassium channel calcium activated intermediate/small conductance subfamily N alpha member 3
    • Potassium channel, calcium activated, intermediate/small conductance, subfamily N, member 3
    • Potassium intermediate/small conductance calcium activated channel subfamily N member 3
    • SK3
    • SKCa 3
    • SKCa3
    • Small conductance calcium-activated potassium channel protein 3
    see all
  • Function
    Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.
  • Sequence similarities
    Belongs to the potassium channel KCNN family. KCa2.3/KCNN3 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152490 stained with Coomassie Blue.

References

ab152490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up