Overview

  • Product name
    Recombinant Human KCNQ5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QNLIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETE TDTFDAAPQPAREAAFASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
    • Amino acids
      833 to 932
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KCNQ 5
    • KCNQ5
    • KCNQ5_HUMAN
    • KQT like 5
    • KQT-like 5
    • Kv7.5
    • OTTHUMP00000064152
    • OTTHUMP00000064153
    • Potassium channel alpha subunit KvLQT5
    • Potassium channel protein
    • Potassium channel subunit alpha KvLQT5
    • Potassium voltage gated channel KQT like subfamily member 5
    • Potassium voltage gated channel subfamily KQT member 5
    • Potassium voltage-gated channel subfamily KQT member 5
    • Voltage gated potassium channel subunit Kv7.5
    • Voltage-gated potassium channel subunit Kv7.5
    see all
  • Function
    Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel which contributes to M-type current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons. May contribute, with other potassium channels, to the molecular diversity of an heterogeneous population of M-channels, varying in kinetic and pharmacological properties, which underlie this physiologically important current. Insensitive to tetraethylammonium, but inhibited by barium, linopirdine and XE991. Activated by niflumic acid and the anticonvulsant retigabine. Muscarine suppresses KCNQ5 current in Xenopus oocytes in which cloned KCNQ5 channels were coexpressed with M(1) muscarinic receptors.
  • Tissue specificity
    Strongly expressed in brain and skeletal muscle. In brain, expressed in cerebral cortex, occipital pole, frontal lobe and temporal lobe. Lower levels in hippocampus and putamen. Low to undetectable levels in medulla, cerebellum and thalamus.
  • Sequence similarities
    Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.5/KCNQ5 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163381 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up