Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSSGRALLDSPLDSGSLTSLGSSVFCSEGEGEPLALGDCFTVNVGGSRF VLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNE YFFDRSSQAFRYVLHYYRTGRLHVMEQLCALSFLQEIQYWGIDELSIDSC CRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNIL EKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQLLEILEYVCI SWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLL LFLSVGISIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRP DTTTGKIVAFMCILSGILVLALPIAIINDRFSACYFTLKLKEAAVRQREA LKKLTKNIATDSYISVNLRDVYARSIMEMLRLKGRERASTRSSGGDDFWF
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KCNV1
    • KCNV1_HUMAN
    • Neuronal potassium channel alpha subunit HNKA
    • Potassium voltage gated channel subfamily V member 1
    • Potassium voltage-gated channel subfamily V member 1
    • Voltage gated potassium channel subunit Kv8.1
    • Voltage-gated potassium channel subunit Kv8.1
    see all
  • Function
    Potassium channel subunit that does not form functional channels by itself. Modulates KCNB1 and KCNB2 channel activity by shifting the threshold for inactivation to more negative values and by slowing the rate of inactivation. Can down-regulate the channel activity of KCNB1, KCNB2, KCNC4 and KCND1, possibly by trapping them in intracellular membranes.
  • Tissue specificity
    Detected in brain.
  • Sequence similarities
    Belongs to the potassium channel family. V (TC 1.A.1.2) subfamily. Kv8.1/KCNV1 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Cell membrane. Has to be associated with another potassium channel subunit to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB2.
  • Information by UniProt

Images

  • ab162054 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up