Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQT LTKYPDTF LEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGEL LLPEGFRENQLLAQEAEF FQLKGLAEEVKSRWEKEQLTPRETTFLEIT DNHDRSQGLRIFCNAPDFISKIKSRIVL VSKSRLDGFPEEFSISSNII QFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMAL KCGFRLLTSL DCSKGSIVHSDALHFIK

Specifications

Our Abpromise guarantee covers the use of ab88177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88177 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • bA321C24.3
    • BTB/POZ domain containing protein KCTD4
    • KCTD 4
    • OTTHUMP00000018343
    • Potassium channel tetramerisation domain containing 4
    see all
  • RelevanceKCTD4 contains a potassium channel tetramerisation domain. The N terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily specific assembly of alpha subunits into functional tetrameric channels. The specific function of KCTD4 is unknown.

References for Recombinant Human KCTD4 protein (ab88177)

ab88177 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"