Recombinant Human KDEL Receptor protein (ab153142)

Overview

  • Product name
    Recombinant Human KDEL Receptor protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLD LFTNYISLYNTCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVV PTAILAFLVNHDFTPLEILWTFSIYLESVAILPQLFMVSKTGEAETITSH YLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFFYLYIT KVLKGKKLSLPA
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ER lumen protein retaining receptor 1
    • ERD 2
    • ERD2
    • ERD2.1
    • ERD21
    • HDEL
    • KDEL (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 1
    • KDEL (Lys-Asp-Glu-Leu) 72 kD endoplasmic reticulum protein retention receptor 1
    • KDEL endoplasmic reticulum protein retention receptor 1
    • KDEL R1
    • KDEL receptor 1
    • KDELR 1
    • KDELR1
    • PM 23
    • PM23
    • Putative MAPK activating protein PM23
    see all
  • Relevance
    Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, which is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. The protein encoded by this gene was the first member of the family to be identified, and it encodes a protein structurally and functionally similar to the yeast ERD2 gene product.
  • Cellular localization
    Endoplasmic reticulum

Images

  • ab153142 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up