Recombinant Human KDELR2 protein (ab161241)

Overview

  • Product name
    Recombinant Human KDELR2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLD LFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVV PVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTH YLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYIT KVLKGKKLSLPA
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 2
    • ELP 1
    • ELP-1
    • ELP1
    • ER lumen protein retaining receptor 2
    • ERD 2 like protein
    • ERD2 like protein 1
    • ERD2-like protein 1
    • ERD2.2
    • ERD22_HUMAN
    • FLJ45532
    • KDEL (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 2
    • KDEL endoplasmic reticulum protein retention receptor 2
    • KDEL receptor 2
    • KDELR 2
    • kdelr2
    see all
  • Function
    Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.
  • Sequence similarities
    Belongs to the ERD2 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab161241 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up