Recombinant Human KDELR3 protein (ab161242)

Overview

  • Product name
    Recombinant Human KDELR3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLD LFTNFISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLV PVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISKTGEAETITTH YLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVT KVLKGKKLSLPMPI
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ER lumen protein retaining receptor 3
    • ERD2L3
    • KDEL (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 3
    • KDEL endoplasmic reticulum protein retention receptor 3
    • KDEL receptor 3
    • KDELR 3
    see all
  • Relevance
    KDELR3 is required for the retention of luminal endoplasmic reticulum proteins. It determines the specificity of the luminal ER protein retention system and is also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab161242 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up