Recombinant Human KDM5A / Jarid1A / RBBP2 protein (ab112347)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP29375
    • SpeciesHuman
    • SequenceKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
    • Molecular weight37 kDa including tags
    • Amino acids191 to 290
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Histone demethylase JARID1A
    • JARID1A
    • Jumonji/ARID domain containing protein 1A
    • Jumonji/ARID domain-containing protein 1A
    • Kdm5a
    • KDM5A_HUMAN
    • Lysine-specific demethylase 5A
    • RBBP-2
    • RBBP2
    • RBP2
    • Retinoblastoma binding protein 2
    • Retinoblastoma-binding protein 2
    see all
  • FunctionHistone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.
  • Sequence similaritiesBelongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • DomainThe GSGFP motif is required for the interaction with SUZ12.
  • Cellular localizationNucleus > nucleolus. Occupies promoters of genes involved in RNA metabolism and mitochondrial function.
  • Information by UniProt

Recombinant Human KDM5A / Jarid1A / RBBP2 protein images

  • 12.5% SDS-PAGE showing ab112347 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human KDM5A / Jarid1A / RBBP2 protein (ab112347)

ab112347 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"