Recombinant Human KDM5A / Jarid1A / RBBP2 protein (ab112347)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      191 to 290
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Histone demethylase JARID1A
    • JARID1A
    • Jumonji/ARID domain containing protein 1A
    • Jumonji/ARID domain-containing protein 1A
    • Kdm5a
    • KDM5A_HUMAN
    • Lysine-specific demethylase 5A
    • RBBP-2
    • RBBP2
    • RBP2
    • Retinoblastoma binding protein 2
    • Retinoblastoma-binding protein 2
    see all
  • Function
    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.
  • Sequence similarities
    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • Domain
    The GSGFP motif is required for the interaction with SUZ12.
  • Cellular localization
    Nucleus > nucleolus. Occupies promoters of genes involved in RNA metabolism and mitochondrial function.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112347 at approximately 36.63kDa stained with Coomassie Blue.

References

ab112347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up