Recombinant human KDM5B / PLU1 / Jarid1B protein (ab198112)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHK IRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKL NFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRK WTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTT DTKDKEYKPHDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTEA RTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRSK KATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDW RCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMV PTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEE EEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIE DHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQ LVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVN FCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTV QKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFM SAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLR
    • Molecular weight
      88 kDa including tags
    • Amino acids
      2 to 751
    • Tags
      His-DDDDK tag N-Terminus
    • Additional sequence information
      NM_006618

Specifications

Our Abpromise guarantee covers the use of ab198112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 0.028 pmole/min/μg

     

    Assay Conditions: 10 µl reaction mix containing assay buffer with 20 mM HEPES (pH 7.4), 50 mM NaCl 500 µM α-ketoglutarate, 25 µM iron, 2mM ascorbic acid, 0.01% Tween-20, 0.5 µM biotinylated peptide substrate, and ab198112 (20 – 100 ng) added to the wells. Add antibody against demethylated K4 peptide. Incubate for 30 min, then Streptavidin-conjugated secondary antibody followed by Alpha Screening detection.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 90 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    ab198112 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

    80 ng/µL DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cancer/testis antigen 31
    • CT31
    • Histone demethylase JARID1B
    • JARID1B
    • Jumonji AT rich interactive domain 1B
    • Jumonji/ARID domain-containing protein 1B
    • Kdm5b
    • KDM5B_HUMAN
    • Lysine (K) specific demethylase 5B
    • Lysine demethylase 5B
    • Lysine specific demethylase 5B
    • Lysine-specific demethylase 5B
    • PLU-1
    • PLU1
    • PPP1R98
    • Protein phosphatase 1 regulatory subunit 98
    • PUT1
    • putative DNA/chromatin binding motif
    • RBBP2H1A
    • RBP2 like
    • RBP2-H1
    • Retinoblastoma-binding protein 2 homolog 1
    • Retinoblastoma-binding protein 2 homolog 1A
    see all
  • Function
    Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level).
  • Sequence similarities
    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • Domain
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.
    The 2 first PHD-type zinc finger domains are required for transcription repression activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • KDM5B / PLU1 / Jarid1B activity assay, reacting biotinylated peptide substrate with  ab198112 at 20-100 ng/well.

  • 4-20% SDS-PAGE analysis of ab198112.

    Lane 1: 3 µg ab198112
    Lane 2: Protein marker

    Stained with Coomassie Blue.

References

ab198112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up