Recombinant Human Keratin 36 protein (ab160141)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRSGLSGLGSCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKETMQFL NDRLANYLEKVRQLERENAELESRIQEWYEFQIPYICPDYQSYFKTIEDF QQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADINGLR RILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRCQLGDRLNVEV DAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQ MQCLISNVEAQLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGE DCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEI RDGKVISSREHVQSRPL
    • Amino acids
      1 to 417
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HA6
    • Hair keratin
    • Hair keratin, type I Ha6
    • HHA6
    • HKA6
    • K36
    • Keratin
    • Keratin hair acidic 6
    • Keratin type I cuticular Ha6
    • keratin, hair, acidic, 6
    • Keratin, hard, type I
    • Keratin, hard, type I, 6
    • keratin, type I cuticular Ha6
    • Keratin-36
    • Krt36
    • KRT36_HUMAN
    • KRTHA6
    • type I cuticular Ha6
    • type I Ha6
    see all
  • Tissue specificity
    Expressed in the hair follicle.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab160141 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up