Recombinant Human Keratocan/KTN protein (ab161287)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human Keratocan/KTN protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVI CPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVI -
Amino acids
253 to 351 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab161287 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as Keratocan.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- CNA2
- KERA
- KERA_HUMAN
see all -
Function
May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. -
Tissue specificity
Cornea. Increased expression in the stroma of keratoconus corneas. Also detected in trachea, and in low levels, in intestine, skeletal muscle, ovary, lung and putamen. -
Involvement in disease
Defects in KERA are the cause of the autosomal recessive cornea plana 2 (CNA2) [MIM:217300]. In CNA2, the forward convex curvature is flattened, leading to a decrease in refraction, reduced visual activity, extreme hyperopia (usually plus 10 d or more), hazy corneal limbus, opacities in the corneal parenchyma, and marked arcus senilis (often detected at an early age). CNA2 is a rare disorder with a worldwide distribution, but a high prevalence in the Finnish population. -
Sequence similarities
Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
Contains 10 LRR (leucine-rich) repeats.
Contains 1 LRRNT domain. -
Post-translational
modificationsBinds keratan sulfate chains. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab161287 has not yet been referenced specifically in any publications.