Recombinant Human KHDRBS3 protein (ab161097)

Overview

  • Product name
    Recombinant Human KHDRBS3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVI NKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGK GSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEE IKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAP AITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVP PTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTPAQSGAD YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
    • Amino acids
      1 to 346
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Etle
    • etoile
    • KH domain containing RNA binding signal transduction associated 3
    • KH domain containing RNA binding signal transduction associated protein 3
    • KH domain-containing
    • KHDR3_HUMAN
    • Khdrbs3
    • RNA binding protein T Star
    • RNA-binding
    • RNA-binding protein T-Star
    • SALP
    • Sam68 like mammalian protein 2
    • Sam68 like phosphotyrosine protein
    • Sam68 like phosphotyrosine protein T STAR
    • Sam68-like mammalian protein 2
    • Sam68-like phosphotyrosine protein
    • signal transduction-associated protein 3
    • SLM 2
    • SLM-2
    • SLM2
    • T STAR
    • TSTAR
    see all
  • Function
    RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. May play a role as a negative regulator of cell growth. Inhibits cell proliferation. Involved in splice site selection of vascular endothelial growth factor. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. Involved in post-transcriptional regulation of HIV-1 gene expression.
  • Tissue specificity
    Ubiquitous with higher expression in testis, skeletal muscle and brain. Expressed in the kidney only in podocytes, the glomerular epithelial cells of the kidney. Strongly expressed after meiosis.
  • Sequence similarities
    Belongs to the KHDRBS family.
    Contains 1 KH domain.
  • Domain
    The proline-rich site binds the SH3 domain of the p85 subunit of PI3-kinase.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues. Isoform 1 C-terminal region is tyrosine-rich, but isoform 2 lacking this C-terminal region is also tyrosine-phosphorylated.
  • Cellular localization
    Nucleus. Localized in a compartment adjacent to the nucleolus, but distinct from the peri-nucleolar one.
  • Information by UniProt

Images

  • ab161097 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up