Recombinant Human KIAA0101 protein (ab171707)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMVRTKADSVPGTYRKVVAARAPRKVLG SSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSE KENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
    • Molecular weight
      14 kDa including tags
    • Amino acids
      1 to 111
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab171707 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • HCV NS5A transactivated protein 9
    • HCV NS5A-transactivated protein 9
    • Hepatitis C virus NS5A transactivated protein 9
    • Hepatitis C virus NS5A-transactivated protein 9
    • KIAA0101
    • L5
    • NS5 ATP9
    • NS5ATP9
    • OEATC
    • OEATC 1
    • OEATC-1
    • OEATC1
    • Overexpressed in anaplastic thyroid carcinoma 1
    • p15(PAF)
    • p15PAF
    • PAF
    • PAF_HUMAN
    • PCNA associated factor
    • PCNA-associated factor
    see all
  • Function
    May be involved in protection of cells from UV-induced cell death.
  • Tissue specificity
    Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas and in non-small-cell lung cancer lines.
  • Cellular localization
    Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171707 (3µg).

References

ab171707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up