Recombinant Human KIAA1191 protein (ab163515)

Overview

  • Product name
    Recombinant Human KIAA1191 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDM GSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAK ATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAE ALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTAL PGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKP SPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVL TPTGF
    • Amino acids
      1 to 305
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain-derived rescue factor p60MONOX
    • Flavin monooxygenase motif-containing protein of 33 kDa
    • FLJ21022
    • Hypothetical protein LOC57179
    • Kiaa1191
    • P33MX_HUMAN
    • P60MONOX
    • Putative monooxygenase p33MONOX
    see all
  • Function
    Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.
  • Tissue specificity
    Down-regulated in the occipital lobe of an early stage Alzheimer disease patients.
  • Sequence similarities
    Belongs to the P33MONOX family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163515 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up