Recombinant Human KIAA1279 protein (ab161903)

Overview

  • Product name
    Recombinant Human KIAA1279 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANVPWAEVCEKFQAALALSRVELHKNPEKEPYKSKYSARALLEEVKALL GPAPEDEDERPEAEDGPGAGDHALGLPAEVVEPEGPVAQRAVRLAVIEFH LGVNHIDTEELSAGEEHLVKCLRLLRRYRLSHDCISLCIQAQNNLGILWS EREEIETAQAYLESSEALYNQYMKEVGSPPLDPTERFLPEEEKLTEQERS KRFEKVYTHNLYYLAQVYQHLEMFEKAAHYCHSTLKRQLEHNAYHPIEWA INAATLSQFYINKLCFMEARHCLSAANVIFGQTGKISATEDTPEAEGEVP ELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKK ELDEEESIRKKAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQ HYVFEAKEFFQIDGYVTDHIEVVQDHSALFKVLAFFETDMERRCKMHKRR IAMLEPLTVDLNPQYYLLVNRQIQFEIAHAYYDMMDLKVAIADRLRDPDS HIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVLRPAMLAKFRV ARLYGKIITADPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELS KEMVSLLPTKMERFRTKMALT
    • Amino acids
      1 to 621
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hypothetical protein LOC26128
    • KBP
    • KBP_HUMAN
    • KIAA1279
    • KIF1-binding protein
    • TTC20
    • Uncharacterized protein KIAA1279
    see all
  • Function
    Required for organization of axonal microtubules, and axonal outgrowth and maintenance during peripheral and central nervous system development. Regulates mitochondrial transport by modulating KIF1B motor activity.
  • Tissue specificity
    Highly expressed in heart, brain, ovary, testis, spinal cord and all specific brain regions examined. Moderate expressed at intermediate level in all other adult tissues examined, as well as in fetal liver and brain. Not expressed in blood leukocytes.
  • Involvement in disease
    Defects in KIAA1279 are the cause of Goldberg-Shprintzen megacolon syndrome (GOSHS) [MIM:609460]. GOSHS is characterized by microcephaly, mental retardation and facial dysmorphism, as well as phenotypes related to Hirschsprung disease syndrome.
  • Sequence similarities
    Belongs to the KIF1-binding protein family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab161903 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up