Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASPVPSVPLGTPVMLAFLAPRIANLKIQLAKLDSEAWPGVLDSERDRLI LINEKEELLKEMRFISPRKWTQGEVEQLEMARKRLEKDLQAARDTQSKAL TERWGWGPRVCRTLLSLAVCPQPPDGGRMRGLRAPGLHPEHAQFRDLSGC RHRKSGKMVCHPVRQLPWNFAW
    • Amino acids
      1 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10865
    • FLJ23369
    • HBeAg-binding protein 3
    • HBEBP3
    • HBEBP36
    • KIAA0869
    • KIBRA
    • Kidney and brain protein
    • Protein KIBRA
    • Protein WWC1
    • WW and C2 domain containing 1
    • WW C2 and coiled-coil domain containing 1
    • WW domain-containing protein 1
    • WWC1
    see all
  • Relevance
    KIBRA is a WW domain containing protein, first identified by yeast 2-hybrid analysis of a human brain cDNA expression library. Gene expression studies have shown that KIBRA is expressed in memory-related brain structures including the hippocampus (dentate gyrus and the CA1 region) and the temporal lobe, 2 key regions for memory, and that the expression of specific KIBRA alleles is significantly associated with memory performance.
  • Cellular localization
    Cytoplasm. Cytoplasm › perinuclear region. Nucleus. Cell projection › ruffle membrane. Note: Co-localizes with PRKCZ in the perinuclear region.

Images

  • ab161587 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up