Overview

  • Product name
    Recombinant Human KIF17 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NMEEDRYRLMLSRSNSENIASNYFRSKWASQILSTDARKSLTHHNSPPGL SCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL
    • Amino acids
      930 to 1029
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1405
    • KIF 17
    • KIF 17B
    • KIF 3 related motor protein
    • KIF 3X
    • KIF17
    • KIF17_HUMAN
    • KIF17B
    • KIF3 related motor protein
    • KIF3-related motor protein
    • KIF3X
    • Kinesin family member 17
    • Kinesin like protein KIF 17
    • Kinesin like protein KIF17
    • Kinesin-like protein KIF17
    see all
  • Information by UniProt

Images

  • ab163595 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up