Overview

  • Product name
    Recombinant Human KIF1C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHF QPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV
    • Amino acids
      1004 to 1103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kif1c
    • KIF1C_HUMAN
    • Kinesin family member 1C
    • Kinesin-like protein KIF1C
    • LTXS1
    see all
  • Function
    Motor required for the retrograde transport of Golgi vesicles to the endoplasmic reticulum. Has a microtubule plus end-directed motility.
  • Tissue specificity
    Expressed in all tissues examined, with most abundant expression in heart and skeletal muscle.
  • Involvement in disease
    Spastic ataxia 2, autosomal recessive
  • Sequence similarities
    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.
    Contains 1 FHA domain.
    Contains 1 kinesin motor domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Cellular localization
    Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • ab161139 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up