Overview

  • Product name
    Recombinant Human Kif2a protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPE TPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQS SSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQ QELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVC VRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFD YAFDDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDF SGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQVYATFFEIYSGKVFDL LNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCRTSGQTS ANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLE GAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMI ATISPGMASCENTLNTLRYANRVKELTVDPTAAGDVRPIMHHPPNQIDDL ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED HRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTEL RDKVKSFRAALQEEEQASKQINPKRPRAL
    • Amino acids
      1 to 679
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDCBM3
    • HK2
    • KIF2
    • KIF2A
    • KIF2A_HUMAN
    • Kinesin 2
    • Kinesin heavy chain 2
    • Kinesin heavy chain member 2
    • Kinesin heavy chain member 2A
    • Kinesin like protein KIF2A
    • Kinesin-2
    • Kinesin-like protein KIF2A
    • KNS2
    • M Kinesin
    see all
  • Function
    Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.
  • Sequence similarities
    Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily.
    Contains 1 kinesin-motor domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle pole. Cytoplasm > cytoskeleton > spindle. Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1.
  • Information by UniProt

Images

  • ab158792 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up