Recombinant Human KIR2DL4 protein (ab158794)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNS FLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKP
    • Amino acids
      32 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD_antigen=CD158d
    • CD158 antigen like family member D
    • CD158 antigen-like family member D
    • CD158d
    • G9P
    • KI2L4_HUMAN
    • Killer cell immunoglobulin like receptor 2DL4
    • Killer cell immunoglobulin like receptor, two domains, long cytoplasmic tail, 4
    • Killer cell immunoglobulin-like receptor 2DL4
    • Killer cell inhibitory receptor 103AS
    • Killer Ig receptor
    • KIR 103AS
    • KIR-103AS
    • KIR103
    • KIR103AS
    • KIR2DL4
    • MHC class I NK cell receptor KIR103AS
    • Natural killer cell inhibitory receptor
    • NK cell receptor
    • NK cell receptor; natural killer cell inhibitory receptor
    • OTTHUMP00000068612
    • OTTHUMP00000068614
    • OTTHUMP00000068615
    see all
  • Function
    Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158794 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up