Recombinant Human Kir6.2 protein (ab114436)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14654
    • SpeciesHuman
    • SequenceRTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLD EDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
    • Molecular weight36 kDa including tags
    • Amino acids301 to 390

Specifications

Our Abpromise guarantee covers the use of ab114436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP sensitive inward rectifier potassium channel 11
    • Beta cell inward rectifier subunit
    • BIR
    • HHF 2
    • HHF2
    • IKATP
    • Inward rectifier K(+) channel Kir6.2
    • Inwardly rectifying potassium channel KIR6.2
    • IRK 11
    • IRK11
    • KCNJ11
    • Kir 6.2
    • Kir6.2
    • MGC133230
    • PHHI
    • Potassium channel inwardly rectifing subfamily J member 11
    • Potassium channel, inwardly rectifying subfamily J member 11
    • Potassium inwardly rectifying channel J11
    • TNDM 3
    • TNDM3
    see all
  • RelevanceATP-sensitive potassium (K(ATP)) channels are found in endocrine cells, neurons and both smooth and striated muscle, where they play an important role in controlling insulin secretion and vascular tone, and protect neurons under metabolic stress. Kir6.2 is a member of the inward rectifier potassium channel family, which is characterised by a greater tendency to allow potassium flow into the cell rather than out of it. It associates with the sulphonylurea receptor SUR1/ABCC8 to form a subfamily of K(ATP) channels that, when mutated or misregulated, are associated with forms of hyperinsulinemic hypoglycemia, neonatal diabetes, or pre-disposition to type 2 diabetes mellitus.
  • Cellular localizationCell Membrane; Multi-pass membrane protein

Recombinant Human Kir6.2 protein images

  • ab114436 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Kir6.2 protein (ab114436)

ab114436 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"