Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPP GALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHF SPNVP
    • Amino acids
      1 to 105
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434C1613
    • FLJ23015
    • kinase interacting with leukemia-associated gene (stathmin)
    • Kinase interacting with stathmin
    • KIS
    • KIS protein kinase
    • KIST
    • OTTHUMP00000029529
    • P-CIP2
    • Serine threonine protein kinase Kist
    • Serine/threonine-protein kinase Kist
    • U2AF homology motif (UHM) kinase 1
    • U2AF homology motif kinase 1
    • UHMK1
    • UHMK1_HUMAN
    see all
  • Function
    Upon serum stimulation, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. May be involved in trafficking and/or processing of RNA.
  • Tissue specificity
    Widely expressed, with highest levels in skeletal muscle, kidney, placenta and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization
    Nucleus. Mostly nuclear.
  • Information by UniProt

Images

  • ab165291 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up