Overview

  • Product name
    Recombinant Human KLC3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAE ALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEA EKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFL GQLRQYDPPAESQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGY EIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATM LNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVLY GKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFED VERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEI LHKEDLPAPLGAPNTGTAGDAEQALRRSSSLSKIRESIRRGSEKLVSRLR GEAAAGAAGMKRAMSLNTLNVDAPRAPGTQFPSWHLDKAPRTLSASTQDL SPH
    • Amino acids
      1 to 503
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kinesin light chain 2
    • Kinesin light chain 3
    • KLC2
    • KLC2 like
    • KLC2-like
    • KLC2L
    • KLC3
    • KLC3_HUMAN
    • KLCt
    • KNS2B
    see all
  • Function
    Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
  • Sequence similarities
    Belongs to the kinesin light chain family.
    Contains 5 TPR repeats.
  • Domain
    The heptad repeat (HR) motif is sufficient for interaction with kinesin heavy (KHL) chains and ODF1. The TPR region is involved in mitochondrial binding.
  • Cellular localization
    Cytoplasm > cytoskeleton. Elongating spermatid tail midpiece, localized in outer dense fibers (ODFs) and associates with mitochondria.
  • Information by UniProt

Images

  • ab165560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up