Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCP MKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
    • Amino acids
      111 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Early growth response, alpha
    • Early growth response, alpha like
    • EGR A
    • EGR alpha
    • EGR(A)
    • EGR-alpha
    • EGRA
    • Egral
    • EGRalpha
    • Gdnfif
    • KLF 10
    • KLF10
    • KLF10_HUMAN
    • Krueppel like factor 10
    • Krueppel like factor10
    • Krueppel-like factor 10
    • Kruppel like factor 10
    • mGIF
    • TGF-beta- inducible early gene
    • TGFB inducible early growth response
    • TGFB inducible early growth response 1
    • TGFB inducible early growth response protein 1
    • TGFB-inducible early growth response protein 1
    • TIEG
    • TIEG 1
    • TIEG-1
    • TIEG1
    • Transforming growth factor beta inducible early growth response
    • Transforming growth factor beta inducible early growth response protein 1
    • Transforming growth factor-beta-inducible early growth response protein 1
    • Zinc finger transcription factor TIEG
    see all
  • Function
    Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis (By similarity). May play a role in the cell cycle regulation.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159701 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up