Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPD MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP VSMTASASSPSSTSTSSSSSSRLASSPTVITSVSSASSSSTVLTPGPLVA SASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAV RSPGNVNNTIVVPLLEDGRGHGKAQMDPRGLSPRQSKSDSDDDDLPNVTL DSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNNQKFPCSISPFSIEST RRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCT WEGCTWKFARSDELTRHYRKHTGVKPFKCADCDRSFSRSDHLALHRRRHM LV
    • Amino acids
      1 to 402
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2700063E05Rik
    • AI225908
    • AI315654
    • AP-2 repressor
    • AP-2rep
    • AP-2rep transcription factor
    • AP2REP
    • B130052C06Rik
    • D530033K05Rik
    • HSPC122
    • KLF12
    • KLF12 zinc finger transcriptional repressor
    • KLF12_HUMAN
    • Krueppel like factor 12
    • Krueppel-like factor 12
    • OTTHUMP00000018503
    • Transcriptional repressor AP 2rep
    • Transcriptional repressor AP-2rep
    see all
  • Function
    Confers strong transcriptional repression to the AP-2-alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161396 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up