Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREA ASPGTPGPPPPPPAASGPGPGAAAAPHLLAASILADLRGGPGAAPGGASP ASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYKSSHLKSHLRT HTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSD HLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPA GL
    • Amino acids
      1 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI843742
    • Basic transcription element binding protein 4
    • Basic transcription element-binding protein 4
    • BTE binding protein 4
    • BTE-binding protein 4
    • BTEB 4
    • BTEB4
    • Dopamine receptor regulating factor
    • DRRF
    • KLF 16
    • Klf16
    • KLF16_HUMAN
    • Krueppel-like factor 16
    • Kruppel like factor 16
    • Likely ortholog of mouse dopamine receptor regulating factor
    • MGC187751
    • Novel Sp1 like zinc finger transcription factor 2
    • Novel Sp1-like zinc finger transcription factor 2
    • NSLP 2
    • NSLP2
    • RCG29340
    • Transcription factor BTEB 4
    • Transcription factor BTEB4
    • Transcription factor NSLP 2
    • Transcription factor NSLP2
    see all
  • Function
    Transcription factor that binds GC and GT boxes and displaces Sp1 and Sp3 from these sequences. Modulates dopaminergic transmission in the brain.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164447 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up