Overview

  • Product name
    Recombinant Human KLF17 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFYGRPQAEMEQEAGELSRWQAA HQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPTIQHFPHSAEMLGSPL VSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQ EMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPSGLPVSASTGIPIMSHT GNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGM PPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGT GRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSW SFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDP QANNNNGEQDSPPAAGP
    • Molecular weight
      46 kDa including tags
    • Amino acids
      2 to 389
    • Tags
      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169919 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris-HCl buffer
    Note: Contains, NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • FLJ40160
    • KLF17
    • KLF17_HUMAN
    • Krueppel like factor 17
    • Krueppel-like factor 17
    • Novel zinc finger protein
    • RP4 675G8.1
    • RP4675G8.1
    • Zfp393
    • Zinc finger protein 393
    • ZNF393
    see all
  • Function
    Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development.
  • Sequence similarities
    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab169919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up