Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWK FARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
    • Amino acids
      263 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KLF 2
    • Klf2
    • KLF2_HUMAN
    • Krueppel-like factor 2
    • Kruppel like factor
    • Kruppel like factor 2
    • Kruppel like factor LKLF
    • Kruppel-like factor 2 (lung)
    • Lklf
    • Lung krueppel like factor
    • Lung krueppel-like factor
    • Lung Kruppel like zinc finger transcription factor
    see all
  • Function
    Binds to the CACCC box in the beta-globin gene promoter and activates transcription.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Ubiquitinated. Polyubiquitination involves WWP1 and leads to proteasomal degradation of this protein.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160964 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up