Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43474
    • SpeciesHuman
    • SequenceMAHHHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ NPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRV FDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEF VQMMTAKGSMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSH MKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFN DLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSF TYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFV AELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISV SKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS FLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTAT
    • Molecular weight58 kDa including tags
    • Amino acids11 to 395
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 80 % SDS-PAGE.
    ab109935 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Endothelial Kruppel like zinc finger protein
    • Epithelial zinc finger protein EZF
    • EZF
    • GKLF
    • gut Kruppel-like factor
    • Gut-enriched krueppel-like factor
    • KLF
    • KLF4
    • KLF4_HUMAN
    • Krueppel-like factor 4
    • Kruppel like factor 4 (Epithelial zinc finger protein EZF) (Gut enriched Krueppel like factor)
    • Kruppel like factor 4 (gut)
    see all
  • FunctionTranscription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Domainthe 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human KLF4 protein images

  • 15% SDS-PAGE showing ab109935 at approximately 58.1 kDa (3µg).

References for Recombinant Human KLF4 protein (ab109935)

ab109935 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"