Recombinant Human KLHL14 protein (ab163589)

Overview

  • Product name
    Recombinant Human KLHL14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV LASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQPSQQQQPPP QEEPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLS LDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEE TKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALFQMSVLWLEHDR ETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMNY HLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKK TWKILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPR FNSWIQLPPMQERRASFYACRLDKHLYVIGGRNETGYLSSVECYNLETNE WRYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVPWLYCYDPVMDVWAR KQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWN ILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTWT ELEGDVAEPLAGPACVTVILPSCVPYNK
    • Amino acids
      1 to 628
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kelch like 14
    • Kelch like 14 (Drosophila)
    • Kelch like protein 14
    • kelch-like family member 14
    • Kelch-like protein 14
    • KIAA1384
    • KLH14_HUMAN
    • KLHL14
    • Printor
    • Protein interactor of Torsin-1A
    • Protein interactor of torsinA
    see all
  • Information by UniProt

Images

  • Anti-GST antibody [EPR4236] (ab111947) at 1/10000 dilution + Recombinant Human KLHL14 protein (ab163589) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Observed band size: 96 kDa (why is the actual band size different from the predicted?)


    Exposure time: 3 minutes


    Blocking and dilution buffer: 5% NFDM/TBST.

  • ab163589 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up