Recombinant Human KLHL20 protein (ab162127)

Overview

  • Product name
    Recombinant Human KLHL20 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGKPMRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKH PRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGE LAESRQTEVVIRDIDERAMELLIDFAYTSQITVEEGNVQTLLPAACLLQL AEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV MESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQL PQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQER PLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVAS MSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTS TCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRR LGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHL GCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLA VVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIK MTHCESHIW
    • Amino acids
      1 to 609
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kelch like ECT2 interacting protein
    • Kelch like protein 20
    • Kelch like protein X
    • Kelch motif containing protein
    • Kelch-like ECT2-interacting protein
    • Kelch-like protein 20
    • Kelch-like protein X
    • KHLHX
    • KLEIP
    • KLH20_HUMAN
    • KLHL20
    • KLHLX
    • RP3-383J4.3
    see all
  • Function
    Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in interferon response. The BCR(KLHL20) E3 ubiquitin ligase complex mediates the ubiquitination of DAPK1, leading to its degradation by the proteasome, thereby acting as a negative regulator of apoptosis. Also acts as a regulator of endothelial migration during angiogenesis by controlling the activation of Rho GTPases.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Cellular localization
    Cytoplasm > perinuclear region. Nucleus. Localizes in the perinuclear region in normal conditions. Following IFN-alpha or IFN-gamma treatment, it is relocalized and sequestrated to the PML nuclear bodies, preventing DAPK1 ubiquitination.
  • Information by UniProt

Images

  • ab162127 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up