Recombinant Human KLHL29 protein (ab165045)

Overview

  • Product name
    Recombinant Human KLHL29 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGP TAVGNGHMAGPLLPPPPPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTI GVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLAS CSLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVI DSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCS ELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYE TVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEAC RDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQ RSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVT LADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDH VER
    • Amino acids
      1 to 503
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KBTBD9
    • Kelch like protein 29
    • kelch repeat and BTB (POZ) domain containing 9
    • Kelch repeat and BTB domain containing protein 9
    • Kelch repeat and BTB domain-containing protein 9
    • Kelch-like protein 29
    • KIAA1921
    • KLH29_HUMAN
    • KLHL 29
    • Klhl29
    see all
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Information by UniProt

Images

  • ab165045 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up