Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSS HHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFI MLTRLVLNS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      132 to 240

Specifications

Our Abpromise guarantee covers the use of ab116987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Killer cell lectin like receptor subfamily C member 3
    • KLRC 3
    • KLRC3
    • NK cell receptor E
    • NKG2 E
    • NKG2 E activating NK receptor
    • NKG2 E type II integral membrane protein
    • NKG2-E type II integral membrane protein
    • NKG2-E-activating NK receptor
    • NKG2E
    • NKG2E activating NK receptor
    • NKG2E type II integral membrane protein
    • NKG2E_HUMAN
    see all
  • Function
    Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
  • Tissue specificity
    Natural killer cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116987 at approximately 37.62kDa.
    Stained with Coomassie Blue.

References

ab116987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up