Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ07444
    • SpeciesHuman
    • SequenceGKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSS HHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFI MLTRLVLNS
    • Molecular weight38 kDa including tags
    • Amino acids132 to 240

Specifications

Our Abpromise guarantee covers the use of ab116987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Killer cell lectin like receptor subfamily C member 3
    • KLRC 3
    • KLRC3
    • NK cell receptor E
    • NKG2 E
    • NKG2 E activating NK receptor
    • NKG2 E type II integral membrane protein
    • NKG2-E type II integral membrane protein
    • NKG2-E-activating NK receptor
    • NKG2E
    • NKG2E activating NK receptor
    • NKG2E type II integral membrane protein
    • NKG2E_HUMAN
    see all
  • FunctionPlays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
  • Tissue specificityNatural killer cells.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human KLRC3 protein images

  • 12.5% SDS-PAGE showing ab116987 at approximately 37.62kDa.
    Stained with Coomassie Blue.

References for Recombinant Human KLRC3 protein (ab116987)

ab116987 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"