Recombinant Human KMT3C / SMYD2 protein (ab153431)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGN HCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENW NPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQ SDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFP DVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDR NDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAA GEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
    • Amino acids
      1 to 433
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Histone methyltransferase SMYD2
    • HSKM B
    • HSKM-B
    • HSKMB
    • KMT3C
    • Lysine N-methyltransferase 3C
    • MGC119305
    • N lysine methyltransferase SMYD2
    • N-lysine methyltransferase SMYD2
    • SET and MYND domain containing 2
    • SET and MYND domain containing protein 2
    • SET and MYND domain-containing protein 2
    • Smyd2
    • SMYD2_HUMAN
    • Zinc finger MYND domain containing 14
    • ZMYND14
    see all
  • Function
    Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.
  • Sequence similarities
    Contains 1 MYND-type zinc finger.
    Contains 1 SET domain.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus.
  • Information by UniProt

Images

  • ab153431 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up