Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPAQTGVPQQVHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGT NTNELLAYTNSALDKSLSSHSEGPKLKEPDIEGKYLGKLGVSGMLDLSED
    • Amino acids
      1181 to 1280
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AATYK 2
    • AATYK2
    • Apoptosis associated tyrosine kinase 2
    • Apoptosis-associated tyrosine kinase 2
    • Brain enriched kinase
    • Brain-enriched kinase
    • BREK
    • CDK5/p35 regulated kinase
    • CDK5/p35-regulated kinase
    • CPRK
    • cyclin-dependent kinase 5/p35-regulated kinase
    • FLJ46659
    • hBREK
    • KIAA1079
    • Kinase phosphatase inhibitor 2
    • Kinase/phosphatase/inhibitor 2
    • KPI 2
    • KPI-2
    • KPI2
    • Lemur tyrosine kinase 2
    • LMR 2
    • LMR2
    • LMTK 2
    • Lmtk2
    • LMTK2_HUMAN
    • PPP1R100
    • protein phosphatase 1, regulatory subunit 100
    • Serine/threonine protein kinase KPI 2
    • Serine/threonine protein kinase KPI2
    • Serine/threonine protein kinase LMTK 2
    • Serine/threonine protein kinase LMTK2
    • Serine/threonine-protein kinase KPI-2
    • Serine/threonine-protein kinase LMTK2
    see all
  • Function
    Phosphorylates PPP1C, phosphorylase b and CFTR.
  • Tissue specificity
    Mainly expressed in skeletal muscle, and weakly in brain and pancreas.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161441 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up