Overview

  • Product name
    Recombinant Human KPNA6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKR RNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLAT TQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALT NIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSV CRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKV SPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE SIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAW AITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILR LGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEH YFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
    • Amino acids
      1 to 536
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11249
    • IMA7_HUMAN
    • Importin alpha 7 subunit
    • Importin alpha S2
    • Importin subunit alpha 7
    • Importin subunit alpha-7
    • IPOA 7
    • IPOA7
    • Karyopherin alpha 6
    • Karyopherin alpha 6 (importin alpha 7)
    • Karyopherin subunit alpha 6
    • Karyopherin subunit alpha-6
    • KPNA 6
    • KPNA 7
    • Kpna6
    • KPNA7
    • MGC17918
    • OTTHUMP00000004532
    see all
  • Function
    Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the importin alpha family.
    Contains 10 ARM repeats.
    Contains 1 IBB domain.
  • Information by UniProt

Images

  • ab161726 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up