Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMTEYKLVVVGAGGVGKSALTIQLIQN HFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGE GFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVD TKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEK TPGCVKIKKC
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 186
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156968 purified using conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    Isoform 2A. The mass of this protein was confirmed by mass spectroscopy.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • c Ki ras2
    • c Kirsten ras protein
    • c-K-ras
    • c-Ki-ras
    • Cellular c Ki ras2 proto oncogene
    • Cellular transforming proto oncogene
    • CFC2
    • cK Ras
    • GTPase KRas
    • K RAS p21 protein
    • K RAS2A
    • K RAS2B
    • K RAS4A
    • K RAS4B
    • K-Ras 2
    • KI RAS
    • Ki-Ras
    • KIRSTEN MURINE SARCOMA VIRUS 2
    • Kirsten rat sarcoma 2 viral (v Ki ras2) oncogene homolog
    • Kirsten rat sarcoma viral oncogene homolog
    • KRAS
    • KRAS proto oncogene, GTPase
    • KRAS1
    • KRAS2
    • N-terminally processed
    • NS
    • NS3
    • Oncogene KRAS2
    • p21ras
    • PR310 c K ras oncogene
    • PR310 cK ras oncogene
    • RALD
    • RASK_HUMAN
    • RASK2
    • Transforming protein p21
    • v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog
    • v Ki ras2 Kirsten rat sarcoma viral oncogene homolog
    see all
  • Function
    Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
  • Involvement in disease
    Defects in KRAS are a cause of acute myelogenous leukemia (AML) [MIM:601626]. AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development.
    Defects in KRAS are a cause of juvenile myelomonocytic leukemia (JMML) [MIM:607785]. JMML is a pediatric myelodysplastic syndrome that constitutes approximately 30% of childhood cases of myelodysplastic syndrome (MDS) and 2% of leukemia. It is characterized by leukocytosis with tissue infiltration and in vitro hypersensitivity of myeloid progenitors to granulocyte-macrophage colony stimulating factor.
    Defects in KRAS are the cause of Noonan syndrome type 3 (NS3) [MIM:609942]. Noonan syndrome (NS) [MIM:163950] is a disorder characterized by dysmorphic facial features, short stature, hypertelorism, cardiac anomalies, deafness, motor delay, and a bleeding diathesis. It is a genetically heterogeneous and relatively common syndrome, with an estimated incidence of 1 in 1000-2500 live births. Rarely, NS is associated with juvenile myelomonocytic leukemia (JMML). NS3 inheritance is autosomal dominant.
    Defects in KRAS are a cause of gastric cancer (GASC) [MIM:613659]; also called gastric cancer intestinal or stomach cancer. Gastric cancer is a malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
    Note=Defects in KRAS are a cause of pylocytic astrocytoma (PA). Pylocytic astrocytomas are neoplasms of the brain and spinal cord derived from glial cells which vary from histologically benign forms to highly anaplastic and malignant tumors.
    Defects in KRAS are a cause of cardiofaciocutaneous syndrome (CFC syndrome) [MIM:115150]; also known as cardio-facio-cutaneous syndrome. CFC syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. Heart defects include pulmonic stenosis, atrial septal defects and hypertrophic cardiomyopathy. Some affected individuals present with ectodermal abnormalities such as sparse, friable hair, hyperkeratotic skin lesions and a generalized ichthyosis-like condition. Typical facial features are similar to Noonan syndrome. They include high forehead with bitemporal constriction, hypoplastic supraorbital ridges, downslanting palpebral fissures, a depressed nasal bridge, and posteriorly angulated ears with prominent helices. The inheritance of CFC syndrome is autosomal dominant.
    Note=KRAS mutations are involved in cancer development.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156968 (3 µg).

References

ab156968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up