Recombinant Human KREMEN2 protein (ab164026)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNR TGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWC YVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQ VCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPG QLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALG PPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGA NVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGW PCPAPPGTPRLRVLPRATGL
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dickkopf receptor 2
    • KREM2_HUMAN
    • KREMEN 2
    • Kremen protein 2
    • Kremen protein 2 precursor
    • Kremen2
    • Kringle containing protein marking the eye and the nose
    • Kringle containing transmembrane protein 2
    • Kringle domain containing transmembrane protein 2
    • Kringle domain-containing transmembrane protein 2
    • Kringle-containing protein marking the eye and the nose
    • KRM 2
    • KRM2
    • MGC10791
    • MGC16709
    see all
  • Function
    Receptor for Dickkopf protein. Cooperates with Dickkopf to block Wnt/beta-catenin signaling. Forms a ternary complex with Dkk1 and LRP6 and induces rapid endocytosis and removal of the Wnt receptor LRP6 from the plasma membrane.
  • Sequence similarities
    Contains 1 CUB domain.
    Contains 1 kringle domain.
    Contains 1 WSC domain.
  • Domain
    Binding to ERLEC1 is mediated by the oligosaccharides linked to the kringle domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164026 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up