Overview

  • Product name
    Recombinant Human KRT28 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALG GGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASY LDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNK IISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVL DELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAA PGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT FARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQA QIGALEEQLHQVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNS CSKSKGFGSGSPGNSSKDLSKTTLVKTVVEELDQRGKVLSSRIHSIEEKT SKMTNGKTEQRVPF
    • Amino acids
      1 to 464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK-28
    • Cytokeratin-28
    • K1C28_HUMAN
    • K25D
    • K28
    • Keratin
    • Keratin 25D
    • Keratin 28
    • Keratin, type I cytoskeletal 28
    • Keratin-25D
    • Keratin-28
    • KRT25D
    • KRT28
    • type I cytoskeletal 28
    • Type I inner root sheath specific keratin 25 irs4
    • Type I inner root sheath-specific keratin-K25irs4
    see all
  • Function
    Essential for the proper assembly of types I and II keratin protein complexes and the formation of keratin intermediate filaments in the inner root sheath (irs).
  • Tissue specificity
    Strongly expressed in skin and scalp, and weak expression observed in thymus. In the hair follicle, expressed in Henle layer, Huxley layer and in the irs cuticle. Expression extends from the bulb region up to the point of differentiation into the three layers. Also present in the medulla of beard hair (at protein level).
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab165749 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up