Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLENTLTESEAHYSSQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLD VRARLECEINTYRSLLESEDCKLPCNPCATTNASGNSCGPCGTSQKGCCN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      337 to 436

Specifications

Our Abpromise guarantee covers the use of ab114955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ha 4
    • HA4
    • Hair keratin
    • Hair keratin, type I Ha4
    • Hard keratin type I 4
    • HHA4
    • HKA4
    • K34
    • Keratin
    • Keratin 34
    • Keratin, hair, acidic, 4
    • Keratin, type I cuticular Ha4
    • Keratin-34
    • KRT34
    • KRT34_HUMAN
    • KRTHA4
    • type I cuticular Ha4
    • type I Ha4
    see all
  • Tissue specificity
    Expressed in the hair follicle.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114955 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up