Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO76011
    • SpeciesHuman
    • SequenceSLENTLTESEAHYSSQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLD VRARLECEINTYRSLLESEDCKLPCNPCATTNASGNSCGPCGTSQKGCCN
    • Molecular weight37 kDa including tags
    • Amino acids337 to 436

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ha 4
    • HA4
    • Hair keratin
    • Hair keratin, type I Ha4
    • Hard keratin type I 4
    • HHA4
    • HKA4
    • K34
    • Keratin
    • Keratin 34
    • Keratin, hair, acidic, 4
    • Keratin, type I cuticular Ha4
    • Keratin-34
    • KRT34
    • KRT34_HUMAN
    • KRTHA4
    • type I cuticular Ha4
    • type I Ha4
    see all
  • Tissue specificityExpressed in the hair follicle.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human KRT34 protein images

  • 12.5% SDS-PAGE showing ab114955 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human KRT34 protein (ab114955)

ab114955 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"