Overview

  • Product name
    Recombinant Human KRT6B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGA CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL QIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQE QGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLK NKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA EAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE LMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGA SGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVGGGSSTIK YTTTSSSSRKSYKH
    • Molecular weight
      88 kDa including tags
    • Amino acids
      1 to 564

Specifications

Our Abpromise guarantee covers the use of ab114809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK-6B
    • CK6B
    • Cytokeratin-6B
    • K2C6B_HUMAN
    • K6b
    • Keratin
    • Keratin epidermal type II K6B
    • Keratin like 1 (a type II keratin sequence)
    • Keratin type II cytoskeletal 6B
    • Keratin-6B
    • KRT6B
    • KRTL1
    • PC2
    • PC4
    • type II cytoskeletal 6B
    • Type-II keratin Kb10
    see all
  • Tissue specificity
    Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.
  • Involvement in disease
    Defects in KRT6B are a cause of pachyonychia congenita type 2 (PC2) [MIM:167210]; also known as pachyonychia congenita Jackson-Lawler type. PC2 is an autosomal dominant ectodermal dysplasia characterized by hypertrophic nail dystrophy resulting in onchyogryposis (thickening and increase in curvature of the nail), palmoplantar keratoderma and hyperhidrosis, follicular hyperkeratosis, multiple epidermal cysts, absent/sparse eyebrow and body hair, and by the presence of natal teeth.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human KRT6B protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human KRT6B protein (ab114809)

ab114809 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up