Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSI IDEVRTQYEEIALKSKAEAEALYQTKFQELQL
    • Amino acids
      251 to 332
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK-71
    • Cytokeratin-71
    • hK6irs
    • hK6irs1
    • K2C71_HUMAN
    • K6IRS1
    • K71
    • KB34
    • Keratin
    • Keratin 6 irs
    • Keratin 6, inner root sheath, 1
    • keratin, type II cytoskeletal 71
    • Keratin-71
    • KRT6IRS
    • KRT6IRS1
    • KRT71
    • MGC119390
    • MGC119391
    • OTTHUMP00000236990
    • type II cytoskeletal 71
    • Type II inner root sheath-specific keratin-K6irs1
    • Type-II keratin Kb34
    see all
  • Function
    Plays a central role in hair formation. Essential component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle.
  • Tissue specificity
    Highly expressed in hair follicles from scalp. Specifically expressed in the inner root sheath (IRS) of the hair follicle. Present in the all 3 IRS layers: the cuticle, the Henle and the Huxley layers. Also detected in the pseudopods of specialized Huxley cells, termed Fluegelzellen, along the area of differentiated Henle cells (at protein level).
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Developmental stage
    In all 3 IRS layers, expression begins simultaneously in adjacent cells of the lowermost bulb above the germinative cell pool and terminated higher up in the follicle with the asynchronous terminal differentiation of each cell layer (at protein level).
  • Information by UniProt

Images

  • ab164983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up