Overview

  • Product name
    Recombinant Human KRT75 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSR TVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE
    • Amino acids
      141 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK-75
    • CK75
    • Cytokeratin 75
    • Cytokeratin-75
    • hK6hf
    • K2C75_HUMAN
    • K6HF
    • K75
    • KB18
    • Keratin
    • Keratin 6 hair follicle
    • Keratin 75
    • Keratin type II cytoskeletal 75
    • Keratin-6 hair follicle
    • Keratin-75
    • Krt75
    • PFB
    • type II cytoskeletal 75
    • Type II keratin 18
    • Type II keratin-K6hf
    • Type-II keratin Kb18
    see all
  • Function
    Plays a central role in hair and nail formation. Essential component of keratin intermediate filaments in the companion layer of the hair follicle.
  • Tissue specificity
    Highly expressed in hair follicles from scalp. Specifically expressed in the of the hair companion layer follicle, a single layered band of flat and vertically oriented cells between the cuboidal outer root sheath (ORS) cells and the inner root sheath (IRS) that stretches from the lowermost bulb region to the isthmus of the follicle. Also expressed in medullated hairs. In nails, it is almost exclusively present in the nail bed (at protein level).
  • Involvement in disease
    Defects in KRT75 may be a cause of loose anagen hair syndrome (LAHS) [MIM:600628]. In LAHS, anagen hairs are easily pulled from the scalp. The hair is relatively sparse and does not grow long. Hair of fair color and hair shafts of reduced caliber, and an early age of onset are features. Usually the hairs are not fragile and there are no areas of breakage.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab160347 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up